PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn315001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 261aa    MW: 28887.8 Da    PI: 7.8715
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn315001genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-103273346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      ++  E++   +++   G++ W++Ia+ ++ g t++++k++w++
       Achn315001 32 QFSDAEEQTMFRLHSVIGNR-WSLIAAQLP-GWTDNDVKNHWNT 73
                     58999***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.77E-161082IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-71037IPR009057Homeodomain-like
PROSITE profilePS5129419.0012579IPR017930Myb domain
SMARTSM007174.8E-92977IPR001005SANT/Myb domain
PfamPF002492.3E-83273IPR001005SANT/Myb domain
CDDcd001679.57E-83375No hitNo description
Gene3DG3DSA:1.10.10.601.6E-153876IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVIITVAGLQ RCGKSCRLRW TTSLRPVLKH RQFSDAEEQT MFRLHSVIGN RWSLIAAQLP  60
GWTDNDVKNH WNTKLKKKLS GMGIDPVTHK PFSHLMAEIA TTLAPPQVAH LAEAALGCFK  120
DEMLHLLTKK RVDFQLQQQP SLTPVATYNT ISNQDGKDDN SIEKIKLGLR RAIQEPNMNL  180
VPSNKPWDSA VATSANFVGT CSPFPESVSG FQYGPPSFGN AGDVSPWNQS MCTGRTCTAG  240
DQQERLHERF EDENGVESEA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-17117940108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268897.11e-141PREDICTED: transcription repressor MYB4
SwissprotQ7XQN15e-80MYB80_ORYSJ; Transcription factor MYB80
TrEMBLD7UAP51e-141D7UAP5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01280.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-77myb domain protein 103